DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG3700

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:345 Identity:90/345 - (26%)
Similarity:143/345 - (41%) Gaps:47/345 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 VTPAPTPTEIFWNQPVPSVPITFAPPVPTITSSPAPAPPPPPPLPTPPAVVTVPPATPPPQRFDP 258
            :||:..|. ||:||.:....:.:......|...|.|....    ...||..|.|......|..:.
  Fly    33 LTPSDCPV-IFYNQHLIGAEVKYCDEFNDIVCCPIPLDHQ----NLKPAEQTRPFEKQCKQYNEV 92

  Fly   259 RSQISSVVCGREGSTTPFIVRGNEFPRGQYPWLSAV----YHKEVRALAFKCRGSLISSSIVISA 319
            ||...|         |||||.|.:....::|:::.:    .:|....:.:.|.||::....|::|
  Fly    93 RSACQS---------TPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTA 148

  Fly   320 AHCVH-----------RMTEDRVVVGLGRYDLDDYGEDG-AEMRNVMRLLWHPDYNTRSYSDA-- 370
            |||:.           .....:.||.||..|.:...:|. .:...|:..:.||.|:|......  
  Fly   149 AHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFK 213

  Fly   371 -DIALITIERPVTFNDIIAPICMWTVEASRTVSTTGFIAGWGRDEDSSRTQYPRVVEAEIASPTV 434
             ||||:.::|...|||.:|.:|:.....:.....|.  ||||...|..::.:...|..:..|..|
  Fly   214 NDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTA--AGWGFTADGVKSSHLLKVNLQRFSDEV 276

  Fly   435 CASTWRGTMVTERSLCAGNRDG-SGPCVGDSGGGLMVKQGDRWLLR---GIVS----AGERG-PA 490
            |....|.::.|....|||:... :..|.|||||.:.|:......|:   ||||    .|.:| |:
  Fly   277 CQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPS 341

  Fly   491 GTCQLNQYVLYCDLSKHINW 510
            ...:::   ||.|..:.|.|
  Fly   342 VYTKVH---LYTDWIESIVW 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 69/262 (26%)
Tryp_SPc 277..511 CDD:214473 69/262 (26%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 67/258 (26%)
Tryp_SPc 102..353 CDD:214473 67/255 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.