DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG10764

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:279 Identity:70/279 - (25%)
Similarity:116/279 - (41%) Gaps:74/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 CGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRV 331
            ||.  ||.|.|..|::.......|::|:::..    .|:|.|::|....|:|||||:.|..:  :
  Fly    30 CGI--STRPKISGGDDAAEPNSIWMAAIFNSS----DFQCGGTIIHMRFVLSAAHCLVRGYD--L 86

  Fly   332 VVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMW--- 393
            .|.||..:::    :.|.:..|:.:..|.|:....|.: ||.|:.:...:.:...:.|||::   
  Fly    87 YVRLGARNIN----EPAAVHTVINVFVHHDFIASEYRN-DIGLLQLSESIVYTVRVQPICIFLDP 146

  Fly   394 ----TVEASRTVSTTGFIAGWGRDEDS-------------SRTQYPRVVEAEIASPTVCASTWRG 441
                :||..:|...    .|||.....             .|.:..|.:...:.|          
  Fly   147 ALKGSVEKLKTFRA----LGWGNRNGKLSIMLQTIYLLHLKRNECKRKLNFNLNS---------- 197

  Fly   442 TMVTERSLCAGNRDGSGPCVGDSGGGLMV-------KQGDRWLLRGIVSAGE---RGPAGTCQLN 496
                 |.:|||.::|. .|.|||||.|..       |..:..|  ||||.|:   ||..      
  Fly   198 -----RQICAGTKNGD-TCRGDSGGPLSTNILFPSNKSYEVQL--GIVSFGDPECRGVG------ 248

  Fly   497 QYVLYCDLSKHINWISENI 515
               :|.|::.:::|||..|
  Fly   249 ---VYTDVTSYVDWISSTI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 64/266 (24%)
Tryp_SPc 277..511 CDD:214473 61/263 (23%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 61/264 (23%)
Tryp_SPc 38..263 CDD:238113 64/266 (24%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437368
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.