DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG12133

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:301 Identity:92/301 - (30%)
Similarity:137/301 - (45%) Gaps:78/301 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 SVVCGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRAL---AFKCRGSLISSSIVISAAHCVHR 325
            |.||| :...:.:||.|.|....|:||...:.::...|.   :..|.||||:|..|::||||:: 
  Fly    50 SRVCG-QSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLN- 112

  Fly   326 MTEDRVV--VGLGRYDLD---DYG--EDGAEMRNVMRLLW--------------HPDYNTRS--- 366
             ..|..|  |.||.:|.:   ||.  .:||:       :|              |..|.||:   
  Fly   113 -VNDFYVARVRLGEHDTENDPDYTWLPNGAK-------IWAPAHVDIDVDLRVPHEQYYTRNGRH 169

  Fly   367 YSDADIALITIERPVTFNDIIAPICMWT-VEASRTVSTTGF------IAGWGRDEDSSRTQYPRV 424
            |:  ||||:.::..|.:...|.|||:|. :|    :||:.|      |||||   ||...|...|
  Fly   170 YN--DIALLRLKSRVKYTLQIRPICIWPGIE----LSTSSFKNFPFQIAGWG---DSGLQQKSTV 225

  Fly   425 V-EAEIA--SPTVCASTWRGTMVTER--SLCAGNRDGSGPCVGDSGGGLMVKQG---DR-WLLRG 480
            : :..|:  ||..|.:.: .|::.::  .:||...||:...:||||..||...|   |: :.|.|
  Fly   226 LRQGTISGMSPDECLNRY-PTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAG 289

  Fly   481 IVSAG------ERGPAGTCQLNQYVLYCDLSKHINWISENI 515
            |.|.|      ..|||         :|...|.:..||.:.|
  Fly   290 ITSYGGGPSSYGYGPA---------VYTKTSSYYEWIKKKI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 87/285 (31%)
Tryp_SPc 277..511 CDD:214473 85/282 (30%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 87/285 (31%)
Tryp_SPc 62..317 CDD:214473 85/282 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.