DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG9377

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:308 Identity:74/308 - (24%)
Similarity:120/308 - (38%) Gaps:58/308 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 PPPLPTPPAVVTVPPATPPPQRFDPRSQISSVVCGREGS----TTPFIVRGNEFPRGQYPWLSAV 294
            |..||||    .:|            .::.|..||....    ..|...:..|...|::|||.||
  Fly    70 PDKLPTP----KIP------------EEMMSCPCGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAV 118

  Fly   295 YHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLD-DYGEDGAEMRNVMRLLW 358
            |..:    .:.|.|:||:...||:.||||.....::|.:..|.:|.. :......:.|:|:..|.
  Fly   119 YGSD----TYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLV 179

  Fly   359 HPDYNTRSYS-DADIALITIERPVTFNDIIAPICMWTVEASRTVSTTGFIAGWGRDEDSSRTQYP 422
            ||:|.....: :..|.|:..|:|......:.|||:.........|.. :::||.|.:.......|
  Fly   180 HPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQC-YVSGWQRSDFGRAAILP 243

  Fly   423 RVVEAEIASPTVCASTWRGTMVTERS------LCAGNRDGSGPCVGD------------SGGGLM 469
            :.....:..|..|.:..|.:::..|.      ||||...|...| ||            ||    
  Fly   244 KRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVC-GDVDMTAVPLMCPLSG---- 303

  Fly   470 VKQGDRWLLRGIVSAGERGPAGTCQLNQYV-LYCDLSKHINWISENIR 516
              ..||:.|.|:::...|     |...|.: :|.::..:..||...:|
  Fly   304 --HDDRFHLAGLLTRTAR-----CDGPQLLGIYTNVKLYRQWIDLKLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 63/257 (25%)
Tryp_SPc 277..511 CDD:214473 61/254 (24%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 62/251 (25%)
Tryp_SPc 105..339 CDD:214473 61/250 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.