DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:276 Identity:63/276 - (22%)
Similarity:97/276 - (35%) Gaps:90/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 IVRGNEFPRGQYPWLSAVYHKEVRALAFK------CRGSLISSSIVISAAHCVHRMTEDRVVVG- 334
            ||.|.....|:.|:        ...|.|.      |.||:|:...|::||||.:..::..:..| 
  Fly    37 IVNGYPAYEGKAPY--------TVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGA 93

  Fly   335 -----------LGRYDL-------DDYGEDGAEMRNVMRLLWH-------PDYNTRSYSDADIAL 374
                       :|..|.       :..|.|.|.:|......||       |.:|.| |:..|   
  Fly    94 TWRTNAQFTHTVGSGDFIQNHNWPNQNGNDIALIRTPHVDFWHMVNKVELPSFNDR-YNMYD--- 154

  Fly   375 ITIERPVTFNDIIAPICMWTVEASRTVSTTGFIAGWGRDEDSSRTQYPRVVEAEIASPTVCASTW 439
                            ..|.|           ..|||.....|:..:...|:.:|.|.:.|:.|:
  Fly   155 ----------------NYWAV-----------ACGWGLTTAGSQPDWMECVDLQIISNSECSRTY 192

  Fly   440 RGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDR------WLLRGIVSAGERGPAGTCQLNQY 498
             ||. .:..||.....|...|.|||||.|::..|.|      |:.....:||.  |:|       
  Fly   193 -GTQ-PDGILCVSTSGGKSTCSGDSGGPLVLHDGGRLVGVTSWVSGNGCTAGL--PSG------- 246

  Fly   499 VLYCDLSKHINWISEN 514
              :..::..::||.:|
  Fly   247 --FTRVTNQLDWIRDN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 62/274 (23%)
Tryp_SPc 277..511 CDD:214473 60/271 (22%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 60/271 (22%)
Tryp_SPc 37..260 CDD:238113 62/274 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.