DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:314 Identity:77/314 - (24%)
Similarity:117/314 - (37%) Gaps:95/314 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 VTVPPATPPPQRFDPRSQISSVVCGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFK--- 305
            |.:..|...|::..|.....:|:....||....|..|.....|:.|:        :..|.|.   
  Fly    10 VAIACAAAQPEKVKPVPLKDAVLGSGSGSIEGRITNGYPAYEGKVPY--------IVGLGFSSDS 66

  Fly   306 ----CRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLW-------- 358
                |.||:|..:.||:||||.|           |.:.:..|  .||        ||        
  Fly    67 GGWWCGGSIIGHTWVITAAHCTH-----------GAHSVTIY--YGA--------LWRLQAQYTH 110

  Fly   359 ---------HPDYNTRSYSDADIALITIERPVTFNDIIAPICM------------WTVEASRTVS 402
                     |.||||.:.:: ||:||.... |.|..:|..:.:            |...||    
  Fly   111 TVGSGHFRQHSDYNTNNLNN-DISLINTPH-VDFWHLINKVELPDGNERHDSFAGWWALAS---- 169

  Fly   403 TTGFIAGWGRDEDS-SRTQYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGG 466
                  ||||..|| ..:.|...|:::|.:...|:|.:...::|:..:|.....|...|.|||||
  Fly   170 ------GWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTDVITDNVICTSTPGGKSTCAGDSGG 228

  Fly   467 GLMVKQGDRWLLRGIVS-AGERG-----PAGTCQLNQYVLYCDLSKHINWISEN 514
            .|::.  ||..|.|:.| ....|     |.|..::..|         ::||.::
  Fly   229 PLVLH--DRSKLVGVTSFVAASGCTSGLPDGFTRVTSY---------LDWIRDH 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 70/279 (25%)
Tryp_SPc 277..511 CDD:214473 68/276 (25%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 68/277 (25%)
Tryp_SPc 43..271 CDD:238113 70/279 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.