DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:268 Identity:65/268 - (24%)
Similarity:93/268 - (34%) Gaps:81/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 IVRGNEFPRGQYPWLSAVYHKEVRALAFK----CRGSLISSSIVISAAHCVHRMTEDRVVVGLGR 337
            |..|...|.|:.|:        ...|.|.    |.||:|:...|::|.||:              
  Fly    37 ITNGYAAPEGKAPY--------TVGLGFSGGWWCGGSIIAHDWVLTAEHCI-------------- 79

  Fly   338 YDLDDYGEDGAEMRNVMRLLWHPDY---------NTRSYSDADIALITI------------ERPV 381
                   .|.|.:.......|..:.         |...:|:||||||.|            |.| 
  Fly    80 -------GDAASVIVYFGATWRTNAQFTHTVGNGNFIKHSNADIALIRIPHVDFWHMVNKVELP- 136

  Fly   382 TFNDIIAPICMWTVEASRTVSTTGFIAGWGRDEDSS-RTQYPRVVEAEIASPTVCASTWRGTMVT 445
            ::||.......|...|          .|||...|.| ...:.:.|:.:|.....|.  |....|.
  Fly   137 SYNDRYNNYNEWWAVA----------CGWGGTYDGSPLPDWLQCVDLQIVHNEECG--WTYGSVG 189

  Fly   446 ERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWL-LRGIVSAG---ERGPAGTCQLNQYVLYCDLSK 506
            :..:|....||...|.|||||.|:...|.:.: :...||:.   ...|||.    |.|.|     
  Fly   190 DNVICTRTVDGKSICGGDSGGPLVTHDGSKLVGVSNFVSSNGCQSGAPAGF----QRVTY----- 245

  Fly   507 HINWISEN 514
            |::||.::
  Fly   246 HLDWIRDH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 65/266 (24%)
Tryp_SPc 277..511 CDD:214473 63/263 (24%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 63/263 (24%)
Tryp_SPc 37..253 CDD:238113 65/266 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436781
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.