DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and psh

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:329 Identity:88/329 - (26%)
Similarity:143/329 - (43%) Gaps:53/329 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 NQPVPSVPITFAPPVPTITSSPAPAPPPPPPLPT-----PPAVVTVPPATPPPQRFDPRSQISSV 265
            |..:.||..:      :.||:.||.......:||     .|||.......   :|...||....|
  Fly    86 NSTITSVSTS------STTSTKAPMTSGRVDVPTFGSGDRPAVAACKKIR---ERKQQRSGNQLV 141

  Fly   266 VCGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDR 330
            :         .||.|.....|.||.::|:.:... ...|:|.||||:|..|::|||||:......
  Fly   142 I---------HIVGGYPVDPGVYPHMAAIGYITF-GTDFRCGGSLIASRFVLTAAHCVNTDANTP 196

  Fly   331 VVVGLGRYDLD--DYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMW 393
            ..|.||..:::  |:......:|:|.   .||.|....|:  |||::.:||.|...|.|.|.|:.
  Fly   197 AFVRLGAVNIENPDHSYQDIVIRSVK---IHPQYVGNKYN--DIAILELERDVVETDNIRPACLH 256

  Fly   394 TVEASRTVSTTGFIAGWGRDEDSSRTQYPRVVEA--EIASPTVCASTWR---GTM------VTER 447
            |.......::..|:||||....::|.:...::.|  |:.....|..::.   |::      |.:.
  Fly   257 TDATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDS 321

  Fly   448 SLCA-GNRDGSGPCVGDSGGGLM----VKQGDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKH 507
            .||| ..:..:..|.|||||.|:    |:.| .:.:.|::|:|     ..|......||..:|.:
  Fly   322 LLCAIDQKLIADACKGDSGGPLIHELNVEDG-MYTIMGVISSG-----FGCATVTPGLYTRVSSY 380

  Fly   508 INWI 511
            :::|
  Fly   381 LDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 72/253 (28%)
Tryp_SPc 277..511 CDD:214473 71/251 (28%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 71/252 (28%)
Tryp_SPc 144..387 CDD:238113 72/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.