DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and sphe

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:222 Identity:62/222 - (27%)
Similarity:101/222 - (45%) Gaps:30/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 AFKCRGSLISSSIVISAAHCVHR----MTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYN 363
            |..|.||::|.:.:::.||||||    :...|:...:|  ..:.|.  |.::.||..:..|||| 
  Fly    48 AHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVG--STNQYA--GGKIVNVESVAVHPDY- 107

  Fly   364 TRSYS-DADIALITIERPVTFNDIIAPICMWTVEASRTVSTTG---FIAGWGRDEDSSRTQYPRV 424
               |: :.::|:||:...:|:.|.|..|.:  |.:...:...|   .:|||||..|.:.:...|.
  Fly   108 ---YNLNNNLAVITLSSELTYTDRITAIPL--VASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQ 167

  Fly   425 VEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSA-GERG 488
            :..::|....|...:...  .|:|.|..:....|.|.||.|||.:.......|...:|.| |.|.
  Fly   168 ISLKVAPEATCLDAYSDH--DEQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRY 230

  Fly   489 PAGTCQLNQYVLYCDLSKHINWISENI 515
            |.         ::..||.:.:||.|.|
  Fly   231 PD---------VFVRLSSYADWIQEQI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 60/219 (27%)
Tryp_SPc 277..511 CDD:214473 58/216 (27%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 60/219 (27%)
Tryp_SPc 42..244 CDD:214473 58/216 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436913
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.