DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG31220

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:324 Identity:84/324 - (25%)
Similarity:128/324 - (39%) Gaps:82/324 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 PPPPPPLPTPPAVVTVPPATPPPQRFDPRSQISSVVCGREGSTTPFIVRGNEFPRGQYPWLSAVY 295
            |.|...||:.|.                        ||:. .||..::.|.|....:||||:.:.
  Fly    83 PKPANTLPSYPD------------------------CGKP-QTTNRVIGGTEPNLNEYPWLAMLL 122

  Fly   296 HKE------VRALAFKCRGSLISSSIVISAAHCV--------------HRMTED--------RVV 332
            ::.      .|.|...|.||||::..|::|||||              |..:.:        |:|
  Fly   123 YRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIV 187

  Fly   333 VGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYS-DADIALITIERPVTFNDIIAPICMWTVE 396
            ......|:|           |..:..|.||:..:|: ..||||:.::.||.:.....|||:....
  Fly   188 CAPTHLDID-----------VESITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYP 241

  Fly   397 ASRTVSTTGFIAGWGR----DEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTER-SLCAGNRDG 456
            .| .:....::||||:    |..|...::..|   ::..|..|:..:.......| .:|||..|.
  Fly   242 RS-LMKFKMYVAGWGKTGMFDTGSKVLKHAAV---KVRKPEECSEKYAHRHFGPRFQICAGGLDN 302

  Fly   457 SGPCVGDSGGGLMVKQGDRW----LLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWISENIR 516
            .|.|.||||..||...|..:    .|.||.|.|  ||.||  :....::...:|...||..::|
  Fly   303 RGTCDGDSGSPLMGTSGRSYETITFLAGITSYG--GPCGT--IGWPSVFTRTAKFYKWIRAHLR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 74/274 (27%)
Tryp_SPc 277..511 CDD:214473 72/271 (27%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 72/272 (26%)
Tryp_SPc 104..360 CDD:238113 74/274 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437200
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.