DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG18420

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:282 Identity:82/282 - (29%)
Similarity:129/282 - (45%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 VVTVPPATPPPQRFDPRSQISSVVCGREG--STTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFK 305
            ::||.|.....|..|..       ||...  ...|.||.|....|...||::.::   ..:..|.
  Fly    14 LLTVFPLLGSTQFLDSE-------CGTRSPLKLGPRIVNGKVAVRNSSPWMAFLH---TSSNQFI 68

  Fly   306 CRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYD--LDDYGEDGAEMRNVMRLLWHPDYNTRSYS 368
            |.|:|||..:|::||||.  :....:||.||.|:  |..|.|:    ..|.|...|..|:..:::
  Fly    69 CGGTLISRRLVLTAAHCF--IPNTTIVVRLGEYNRKLKGYREE----HQVNRTFQHRFYDPNTHA 127

  Fly   369 DADIALITIERPVTFNDIIAPIC-MWTVEASRTVST----TGFIAGWGRDEDSSRTQYPRVVEAE 428
            : ||||:.:...|.:...|.||| ||.......:.:    ||  .||||.|....:...|.::..
  Fly   128 N-DIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTG--TGWGRTESMHDSSELRTLDIS 189

  Fly   429 IASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGG--GLMVKQGD--RWLLRGIVSAGERGP 489
            .....:||.   |::::.: .||||.: |..|:||:||  |.||:..:  |::..||....:|  
  Fly   190 RQPSKMCAF---GSVLSNQ-FCAGNWN-SNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKR-- 247

  Fly   490 AGTCQLNQYVLYCDLSKHINWI 511
               ||  :..::.|:..||.:|
  Fly   248 ---CQ--RPSVFTDVMSHIEFI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 74/246 (30%)
Tryp_SPc 277..511 CDD:214473 73/244 (30%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 73/245 (30%)
Tryp_SPc 43..267 CDD:238113 74/246 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.