DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG30323

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:287 Identity:52/287 - (18%)
Similarity:87/287 - (30%) Gaps:108/287 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 YHKEVRALAFK-----------CRGSLISSSIVISAAHCVHRMTED-----------RVVV---- 333
            ||:.|.::..:           |.|||:|:..|:::..||....|.           ||||    
  Fly    32 YHQNVVSIRTRKHIRHWGDNHFCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPK 96

  Fly   334 -----------GLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDII 387
                       .:.:..||:....|.                     .::||:.::|.||.....
  Fly    97 RLKKPSPKNIYHVQKIVLDESAISGC---------------------TELALLKLDRGVTGQRFA 140

  Fly   388 APICMWTVEASRTVSTTGFI--AGWGRDEDSSRTQYPRVVEAEIASPTVC-----ASTW------ 439
            ..:      ..:.:::|...  .|||      |..|...|......|...     ..||      
  Fly   141 MML------PEKELNSTWLCNSLGWG------RIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPY 193

  Fly   440 -------RGTMVTE--------RSLCAGNRDGSG-PCVGDSGGGLMVKQGDRWLLRGIVSAGERG 488
                   |...::|        |.||..:..|.| .|..|.|..|..   |.:|.      |...
  Fly   194 SSELIQIRAQKISEYECKPDCSRCLCMTSYTGRGNMCQQDLGSPLFC---DHFLY------GVAR 249

  Fly   489 PAGTCQLNQYVLYCDLSKHINWISENI 515
            ...||....::.|.::.::..:|.:.:
  Fly   250 RVHTCDDEGFMFYTNIYQNRKFIEDTL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 52/284 (18%)
Tryp_SPc 277..511 CDD:214473 51/281 (18%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 49/271 (18%)
Tryp_SPc 45..272 CDD:214473 48/268 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.