DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG30091

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:259 Identity:70/259 - (27%)
Similarity:117/259 - (45%) Gaps:26/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 CGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTED-- 329
            ||......|.||.|.:....:.||::.:...:    .|.|.||:|::..|::||||:  .|::  
  Fly    27 CGVPMQLIPKIVGGVDAGELKNPWMALIKTND----EFICGGSVITNKFVLTAAHCM--CTDEEC 85

  Fly   330 -----RVVVGLGRYDLDDYGEDG--AEMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDII 387
                 ::.|.||.|.|...||..  .|:.||.|:..|..:..::|.: ||||:.:::.:.:...|
  Fly    86 IVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRN-DIALLRLQKSIVYKPQI 149

  Fly   388 APICMWTVE--ASRTVSTTGFIA-GWGRDEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTERSL 449
            .|:|:...:  ..:|.....|.| |||...:...:...::|:.......:|.:.:..|. .....
  Fly   150 KPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTF-DYPMF 213

  Fly   450 CAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAGERG--PAGTCQLNQYVLYCDLSKHINWI 511
            |||...|...|..||||.|.:    ..|..||..|.:.|  ..||.....:.:|.|:..||::|
  Fly   214 CAGTAVGRDTCKRDSGGPLYI----HMLFDGIKRATQLGIVSTGTEDCRGFGMYTDVMGHIDFI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 67/249 (27%)
Tryp_SPc 277..511 CDD:214473 66/247 (27%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 66/248 (27%)
Tryp_SPc 37..276 CDD:238113 67/249 (27%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm50645
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.