DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG30090

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:278 Identity:86/278 - (30%)
Similarity:129/278 - (46%) Gaps:51/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 DPRSQISSVVCGREGSTTPF-IVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAA 320
            :||       ||...:|..| |:.|.:......||: |..|..|:.:   |.|:||:...|::||
  Fly    26 EPR-------CGLTANTIAFKIIGGRDAIINSNPWM-AYIHSSVKLI---CGGTLITQRFVLTAA 79

  Fly   321 HCVHRMTEDRVVVGLGRYDLDDYGED--------GAEMRNVMRLLWHPDYNTRSYSDADIALITI 377
            |||:.  ...|.|.||.|| |...||        .||..:|.....|..::.....: ||||:.:
  Fly    80 HCVNE--GSAVKVRLGEYD-DTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLN-DIALLRL 140

  Fly   378 ERPVTFNDIIAPICMWTVEASRTV--STTGFIA-GWGRDEDSSRTQYPR----VVEAEIASPTVC 435
            .:.|||...|:|||:....:.|.:  |...|:| |||    .:||...|    :.:.:..:.:.|
  Fly   141 AKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWG----ETRTHRTRGVLQITQLQRYNSSQC 201

  Fly   436 ASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLM--VKQGDRWLLR----GIVSAGERGPAGTCQ 494
            ... .|.:|.:..:||| |.||..|.|||||.|.  |:..|:  :|    |:||.|.|..:|   
  Fly   202 MQA-LGRLVQQNQICAG-RLGSDTCNGDSGGPLFQTVRHMDK--MRPVQFGVVSYGSRECSG--- 259

  Fly   495 LNQYVLYCDLSKHINWIS 512
               ..:|.|:..:.:||:
  Fly   260 ---IGVYTDVYSYADWIA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 80/257 (31%)
Tryp_SPc 277..511 CDD:214473 78/254 (31%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 78/255 (31%)
Tryp_SPc 40..276 CDD:238113 80/257 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.