DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG30087

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:269 Identity:76/269 - (28%)
Similarity:125/269 - (46%) Gaps:38/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 SQISSVVCG--REGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHC 322
            :|..:.:||  .|..|...:|.|.|......|::..|.:..:.    .|.||:::|..:::||||
  Fly    23 AQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLT----HCGGSILNSRYILTAAHC 83

  Fly   323 VH-----RMTEDRVVVGLGRYDLDDYGED---GAEMRNVMRLLWHPDYNTRSYSDADIALITIER 379
            |.     |:.|..:     |.|.|..|.:   .:|...:|:.:.|..||..::.: ||||:.:.|
  Fly    84 VFPNLRLRLGEHNI-----RTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVN-DIALLKLNR 142

  Fly   380 PVTFNDIIAPICMWTVEASRTVSTTGFIAGWGRDEDSSRTQYPRVVE-AEIAS--PTVCASTWRG 441
            .:.||..|.|||:....||.....|....|||   ::.:..:|.::: ||:.:  ...|:.::..
  Fly   143 SINFNVHIQPICILLNPASAPSVATYQTFGWG---ETKKNGFPHLLQTAELRAYDAAYCSRSFHA 204

  Fly   442 TMVTERSLCAGNRDGSGPCVGDSGGGLMVKQG----DRWLLRGIVSAGERGPAGTCQLNQYVLYC 502
            .| ....:|||:.: ...|.|||||.|:.:..    .|:|..||||.|..    .||  ...:|.
  Fly   205 YM-NGNQICAGHEE-RDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPT----DCQ--SPGVYT 261

  Fly   503 DLSKHINWI 511
            .:..:||||
  Fly   262 YVPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 71/250 (28%)
Tryp_SPc 277..511 CDD:214473 69/248 (28%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 69/249 (28%)
Tryp_SPc 42..272 CDD:238113 71/250 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.