DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and try-6

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001361988.1 Gene:try-6 / 185959 WormBaseID:WBGene00006624 Length:343 Species:Caenorhabditis elegans


Alignment Length:281 Identity:49/281 - (17%)
Similarity:85/281 - (30%) Gaps:108/281 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 CGREGSTTPFIVRGNEFPRGQYPWLSAV-YHKEVRAL----AFKCRGSLISSSIVISAAHCVHRM 326
            ||:...:.  |..|.:....:.||...: .:..|:.:    :..|.|:|.|...:::|.||....
 Worm    33 CGKNVKSK--IFNGRKAEIDEAPWAVRINTYTNVKNIDETWSKHCSGTLTSPRHILTATHCAATY 95

  Fly   327 TE--------------------------------------DRVVVGLGRYDLDDYGEDGAEMRNV 353
            ||                                      :|..:|..:|         ..|.|.
 Worm    96 TETEWNGTVIDAPIYRKYCEEQSTLIVREVAASRIVVRLRNRTEIGRAKY---------LFMFNY 151

  Fly   354 MRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTVSTTGFIAGWGRD----- 413
            .|.:...:.....|.| ||.:|.:...|.::..:.|:|:.........::...:.|:|.|     
 Worm   152 CRKIVDKNAYEIQYPD-DIMIIELSEDVEYSSELKPVCVAGNTDDNAPNSHLDLFGFGDDPPRDK 215

  Fly   414 ------------------------EDSSRTQYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNR 454
                                    |.:|:...||:..|:..:.|..|                  
 Worm   216 PSSLKNLHDIPLKHHKVEIMDMNKEGTSKRMDPRLFIAKSVTRTSVA------------------ 262

  Fly   455 DGSGPCVGDSGGGLMVKQGDR 475
                 |.||||.| .||:.|:
 Worm   263 -----CPGDSGAG-GVKEIDK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 47/271 (17%)
Tryp_SPc 277..511 CDD:214473 47/271 (17%)
try-6NP_001361988.1 DUF316 7..320 CDD:367641 49/281 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D294086at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.