DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG43742

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:237 Identity:68/237 - (28%)
Similarity:112/237 - (47%) Gaps:42/237 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 WLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAE----- 349
            :::|:|:..    .|.|.||||....|::|||||..:  |.|.|.|        ||:...     
  Fly    46 FMAALYNNS----EFFCGGSLIHKQYVLTAAHCVRDL--DEVTVHL--------GENNRSCPIPV 96

  Fly   350 MRNVMRL----LWHPDYNTRSYSDADIALITIERPVTFNDIIAPICMWTVEASRTVSTTGFIA-G 409
            .::|:||    :.||:::...:.: ||||:.:||.|.|...|.|||:...|...:.:...|.| |
  Fly    97 CKHVLRLNAKVILHPNFHGNIFLN-DIALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFTAYG 160

  Fly   410 WGRDEDSSRTQYPRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGG---GLMVK 471
            ||:.|..:.:.....::......::|..       ...::|||:..|. .|..||||   |..|.
  Fly   161 WGKTEHGNISDVLSFIDLVRLPKSMCYQ-------NINTICAGSTSGD-TCESDSGGPLIGNFVH 217

  Fly   472 QG-DRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWIS 512
            :| .|.:|.||.|.|:...:|.     :.:|.|::.:.:||:
  Fly   218 RGKSRDILFGITSYGDAECSGL-----FGVYTDVNAYKSWIA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 68/237 (29%)
Tryp_SPc 277..511 CDD:214473 66/234 (28%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 66/234 (28%)
Tryp_SPc 35..256 CDD:238113 68/237 (29%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.