DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sp212 and CG42694

DIOPT Version :9

Sequence 1:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:226 Identity:57/226 - (25%)
Similarity:94/226 - (41%) Gaps:50/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 CRGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRL-LWHPDYNT--RSY 367
            |.|||||...|:|||.|:.  ...::.|.||             :.|..:. .|:...|.  .|:
  Fly    58 CSGSLISKQFVLSAAQCID--VHGKLFVQLG-------------VSNATKSPHWYTVSNVVIPSH 107

  Fly   368 S----DADIALITIERPVTFNDIIAPIC-------MWTVEASRTVSTTGFIAGWGRDEDSSRTQY 421
            |    ..||.|:.:.:.|.:||.:.|||       :..|:..:..:|:.::         |:.:.
  Fly   108 SGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAWL---------SKNKN 163

  Fly   422 PRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLM--VKQGD---RWLLRGI 481
            |:.:.....|...|.....|. ||.:.:||.:...:..|..|||..|.  :.||.   |.:|.||
  Fly   164 PQTIVLSQLSRDRCKLNLSGN-VTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGI 227

  Fly   482 VSAGERGPA-GTCQLNQYVLYCDLSKHINWI 511
                 ||.. |....::..:|.|:::.:.||
  Fly   228 -----RGYVNGRSWCSEPAIYIDVAECVGWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 57/226 (25%)
Tryp_SPc 277..511 CDD:214473 55/224 (25%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 57/226 (25%)
Tryp_SPc 46..253 CDD:214473 55/224 (25%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.