DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and HAND1

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_004812.1 Gene:HAND1 / 9421 HGNCID:4807 Length:215 Species:Homo sapiens


Alignment Length:132 Identity:43/132 - (32%)
Similarity:67/132 - (50%) Gaps:26/132 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PFSRRSHKPRRLKC-ASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKL 130
            |.:|....|.||:. ..::.:::.:...:||||.:|||.||..||..||.:|.:.:|||:.||:|
Human    74 PDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRL 138

  Fly   131 AISYITFLSEMVKKDKNGNEP------------GLSLQRNYQKE-----PP------KKIILKDR 172
            |.|||.:|.:::.||....:|            |...:|..:.:     ||      |:|  |.|
Human   139 ATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRI--KGR 201

  Fly   173 TG 174
            ||
Human   202 TG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 25/51 (49%)
HAND1NP_004812.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 9/34 (26%)
bHLH_TS_HAND1 94..153 CDD:381522 25/58 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..198 5/31 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.