DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and neurod6

DIOPT Version :10

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001072273.1 Gene:neurod6 / 779726 XenbaseID:XB-GENE-969227 Length:337 Species:Xenopus tropicalis


Alignment Length:104 Identity:19/104 - (18%)
Similarity:37/104 - (35%) Gaps:25/104 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 MVGKP-PFRGKT--------------------TSEIYDAIIEHKLKFPRSFNLAAKDLVKKLLEV 249
            |.|:| |:|.|.                    ..:.|:.:.::..:.|.. ..|...|.:..:.|
 Frog    89 MAGEPKPYRPKPGNKRPLSALYSGYVFDYDYYRDDFYNRLFDYHGRVPPP-PRAVIPLKRPRVAV 152

  Fly   250 DRTQR---IGCMKNGTQDVKDHKWFEKVNWDDTLHLRVE 285
            ..|:|   :..||.|::.........|:..|:...::.|
 Frog   153 TTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 bHLH_TS_PTF1A 87..142 CDD:381423
neurod6NP_001072273.1 bHLH_TS_NeuroD4_ATOH3 74..151 CDD:381564 10/62 (16%)
Neuro_bHLH 153..272 CDD:463621 8/39 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.