DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and mespa

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001039184.1 Gene:mespa / 734031 XenbaseID:XB-GENE-920825 Length:310 Species:Xenopus tropicalis


Alignment Length:114 Identity:32/114 - (28%)
Similarity:54/114 - (47%) Gaps:18/114 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SSGF----------NSDQENTEKTFCPFSRRSHKPRRLKCASQMAQQ------RQAANLRERRRM 99
            ||||          |....:....|....:...||:..........:      |.:|:.||:.||
 Frog    44 SSGFSPPYPSCAFANEAYGSIHTAFTQMEKLKSKPQDTSTKKDQRNRKVYDRVRNSASEREKMRM 108

  Fly   100 QSINEAFEGLRTHIP--TLPYEKRLSKVDTLKLAISYITFLSEMVKKDK 146
            ::::.|.:.||.::|  ..|..|.|:|::||:|.|.||:.|||::..|:
 Frog   109 RNLSSALQNLRRYLPPAVAPIGKTLTKIETLRLTIRYISHLSEVLGLDE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 21/53 (40%)
mespaNP_001039184.1 bHLH_SF 97..160 CDD:381792 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.