DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and msgn1

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001039104.1 Gene:msgn1 / 733924 XenbaseID:XB-GENE-972085 Length:172 Species:Xenopus tropicalis


Alignment Length:153 Identity:42/153 - (27%)
Similarity:66/153 - (43%) Gaps:37/153 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NASTSSS--DYFFGDEHSSESDDEDD-------AYSSGFNSDQENTEKTFCPFS----------- 69
            |:|..:|  |:...||..|.|.....       :|.|.::|..........|||           
 Frog    24 NSSCMASTWDWKNNDERYSLSQTPSPQSLSPAVSYESPYSSSSHTQGLEEMPFSYSLLQYPSLCH 88

  Fly    70 ---------RRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKR--LS 123
                     ...|||      |...|:|:.|:.||:.||::|.||...||.::|.:..:.|  |:
 Frog    89 GDNGDLTKKDHGHKP------SMTVQRRRKASEREKLRMRAIAEALHTLRNNLPPMYSQGRQPLT 147

  Fly   124 KVDTLKLAISYITFLSEMVKKDK 146
            |:.|||..|:||:.|:.:::..|
 Frog   148 KIQTLKCTINYISELTNLLQCSK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 20/53 (38%)
msgn1NP_001039104.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 11/44 (25%)
bHLH_TS_Msgn1 102..167 CDD:381509 26/70 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.