DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and Atoh8

DIOPT Version :10

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_722473.1 Gene:Atoh8 / 71093 MGIID:1918343 Length:322 Species:Mus musculus


Alignment Length:101 Identity:32/101 - (31%)
Similarity:50/101 - (49%) Gaps:13/101 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SHKPRR-----------LKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKV 125
            |..||:           :|...|  .:|..||.|||.|:.:|:.|||.||..:|...|.::|||:
Mouse   208 SASPRKRPGEATAASTEIKALQQ--TRRLLANARERTRVHTISAAFEALRKQVPCYSYGQKLSKL 270

  Fly   126 DTLKLAISYITFLSEMVKKDKNGNEPGLSLQRNYQK 161
            ..|::|.:||..|:.:...|.:.:...||.....|:
Mouse   271 AILRIACNYILSLARLADLDYSADHSNLSFSECVQR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 bHLH_TS_PTF1A 87..142 CDD:381423 23/54 (43%)
Atoh8NP_722473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..96
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..144
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..221 3/12 (25%)
bHLH_TS_ATOH8 225..292 CDD:381427 26/68 (38%)
Basic motif, degenerate. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 231..244 6/12 (50%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 245..283 15/37 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.