DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and Msgn1

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001103021.1 Gene:Msgn1 / 689864 RGDID:1587516 Length:187 Species:Rattus norvegicus


Alignment Length:127 Identity:36/127 - (28%)
Similarity:59/127 - (46%) Gaps:23/127 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 HSSESDDEDDAYSSGFNSDQENTEKTFCPFSRRSHKPRRLKCASQM-----------AQQRQAAN 92
            ||..|....|.|||     .|........:|..:.:|..:..|..:           .|:|:.|:
  Rat    65 HSGASTGGSDGYSS-----HEAGGLVELDYSMLAFQPSYIHAAGGLKGQKGSKVKMSVQRRRKAS 124

  Fly    93 LRERRRMQSINEAFEGLRTHIPTLPYEKR---LSKVDTLKLAISYITFLSEMVKKDKNGNEP 151
            .||:.||:::.:|...||.::|.: |.:|   |:|:.|||..|.||..|::::   ..|.||
  Rat   125 EREKLRMRTLADALHTLRNYLPPV-YSQRGQPLTKIQTLKYTIKYIRELTDLL---NGGREP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 19/54 (35%)
Msgn1NP_001103021.1 HLH 119..173 CDD:278439 20/54 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.