powered by:
Protein Alignment Fer1 and TAL1
DIOPT Version :9
Sequence 1: | NP_001262334.1 |
Gene: | Fer1 / 2768661 |
FlyBaseID: | FBgn0037475 |
Length: | 256 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001274276.1 |
Gene: | TAL1 / 6886 |
HGNCID: | 11556 |
Length: | 331 |
Species: | Homo sapiens |
Alignment Length: | 73 |
Identity: | 30/73 - (41%) |
Similarity: | 45/73 - (61%) |
Gaps: | 8/73 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 QRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMV--------K 143
:|...|.|||.|.|::|.||..||..|||.|.:|:|||.:.|:||:.||.||:::: :
Human 188 RRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQ 252
Fly 144 KDKNGNEP 151
:.|.|.:|
Human 253 RAKTGKDP 260
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.