DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and ASCL2

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_005161.1 Gene:ASCL2 / 430 HGNCID:739 Length:193 Species:Homo sapiens


Alignment Length:193 Identity:53/193 - (27%)
Similarity:79/193 - (40%) Gaps:57/193 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CPFSRRSHKPRRLKCASQMAQQRQAA--------------NLRERRRMQSINEAFEGLRTHIPTL 116
            |...||...|..|:|    :::|:.|              |.|||.|::.:|..|:.||.|:|..
Human    20 CAARRRPASPELLRC----SRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHG 80

  Fly   117 PYEKRLSKVDTLKLAISYITFLSEMVKKD---KNGNEPGL---SLQRNYQKEPPKKIILKDRTGG 175
            ...|:||||:||:.|:.||..|..::.:.   :|....||   :::.:..:.||       .|..
Human    81 GASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPP-------GTTP 138

  Fly   176 VAHSLSWYRKGDRYPGSKLYARTWTPEDPRGPHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGA 238
            ||.|.|   :....||             ||..|:|          .:..|..||||....||
Human   139 VAASPS---RASSSPG-------------RGGSSEP----------GSPRSAYSSDDSGCEGA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 22/51 (43%)
ASCL2NP_005161.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..56 2/18 (11%)
HLH 66..108 CDD:197674 17/41 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..177 22/91 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.