DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and Fer2

DIOPT Version :10

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster


Alignment Length:116 Identity:51/116 - (43%)
Similarity:69/116 - (59%) Gaps:22/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ASQMAQQRQAANLRERRRMQ----------SINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYI 135
            ||....||||||:|||:|:|          |||.||:.||.|:||.||||||||:|||:|||:||
  Fly   142 ASSYKMQRQAANVRERKRIQRSAPTGYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYI 206

  Fly   136 TFLSEMVKKDKNGNEPGLSLQRNYQKEPPKKIILKDR----TGGVAHSLSW 182
            :.|.|:::.|   .:|...:::..:.|     |..||    |..:...|||
  Fly   207 SLLREVLQTD---YDPLTYVEKCLRGE-----IKADRANWNTSDLTARLSW 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 bHLH_TS_PTF1A 87..142 CDD:381423 39/64 (61%)
Fer2NP_001287359.1 bHLH_SF 144..216 CDD:469605 39/71 (55%)

Return to query results.
Submit another query.