DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and sage

DIOPT Version :10

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster


Alignment Length:178 Identity:44/178 - (24%)
Similarity:63/178 - (35%) Gaps:41/178 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ESFSLSQLERIITIGKGTFGRVELARDKITGAHYALKVLNIRRV-VDMRQTQHVHNEKRVLLQLK 73
            |.|..::||.|:.      ..|||.:.:|.    .||..|:... ||.:......|.:..:..|:
  Fly   312 ERFKTTKLEEILN------EAVELQQAEIA----TLKEQNLMATRVDYQHNDRFRNVEENMESLQ 366

  Fly    74 HPFIVKMYASEKDSNHLYMIMEFVPGGEMFSYLRASRSFSNSMAR--FYASEIV-----CALEYI 131
                          |||..|...:..      :|..:..||...|  ..|..||     .||..:
  Fly   367 --------------NHLVRIENALMD------VRQVKLTSNVWQRVALNAGNIVVELLKIALFVV 411

  Fly   132 HSLGIVYRDLK-PENLMLSKEGHIKMADFGFAKELRDRTYTICG-TPD 177
            .|:..:.|.|. ..|......|.:.:|.| |...|:..||...| |||
  Fly   412 ASILDLVRPLTGSRNRSAMAFGLVFLAIF-FGHHLQKVTYLFGGSTPD 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 bHLH_TS_PTF1A 87..142 CDD:381423 15/61 (25%)
sageNP_524287.1 bHLH_TS 181..236 CDD:381396
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.