DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and Bhlha9

DIOPT Version :10

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_796156.3 Gene:Bhlha9 / 320522 MGIID:2444198 Length:231 Species:Mus musculus


Alignment Length:117 Identity:38/117 - (32%)
Similarity:54/117 - (46%) Gaps:24/117 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 STSSSDYFFGDEHSSESDDEDDAYSSGFNSDQENTEKTFCPFSRRSHKPRRLKCASQMAQQRQAA 91
            |.|.:...||....|..|:.::|                  ..|:..:|.|.|.      :|.||
Mouse    26 SCSEAGRNFGVLRRSSLDEAEEA------------------AGRKRERPTRSKA------RRMAA 66

  Fly    92 NLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVK 143
            |:|||:|:...||||..||..:......|||||:.||:.||..||.||.:::
Mouse    67 NVRERKRILDYNEAFNALRRALQHDLGGKRLSKIATLRRAIHRITALSLVLR 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 bHLH_TS_PTF1A 87..142 CDD:381423 27/54 (50%)
Bhlha9NP_796156.3 bHLH_TS_bHLHa9 55..117 CDD:381482 30/67 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..168
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.