DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and sc

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster


Alignment Length:179 Identity:45/179 - (25%)
Similarity:73/179 - (40%) Gaps:39/179 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSMDNFDLEATMARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAYSSGFNSDQENTEKTF 65
            |.:.:|.....||:......::....:.:|:...|..:|..      .|.|.......:|.....
  Fly     1 MKNNNNTTKSTTMSSSVLSTNETFPTTINSATKIFRYQHIM------PAPSPLIPGGNQNQPAGT 59

  Fly    66 CPFSRRSHKPRRL---KCASQM----------------AQQRQAANLRERRRMQSINEAFEGLRT 111
            .|...|.:.||.:   :|:..:                :|..|..|.|||.|::.:|.:|..||.
  Fly    60 MPIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRRNARERNRVKQVNNSFARLRQ 124

  Fly   112 HIPTL------------PYEKRLSKVDTLKLAISYITFLSEMVKKDKNG 148
            |||..            |: |::||||||::|:.||..|.::| .|.||
  Fly   125 HIPQSIITDLTKGGGRGPH-KKISKVDTLRIAVEYIRRLQDLV-DDLNG 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 25/63 (40%)
scNP_476803.1 HLH 105..163 CDD:278439 23/58 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.