DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and ac

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster


Alignment Length:224 Identity:53/224 - (23%)
Similarity:90/224 - (40%) Gaps:69/224 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DEHSSESDDEDDAYSSGFNSDQENTEKTFCPFSRRSHKPRRLKCASQMAQQRQAANLRERRRMQS 101
            :.||..:|||:.  ||.||.                  |..::           .|.|||.|::.
  Fly     6 ENHSVFNDDEES--SSAFNG------------------PSVIR-----------RNARERNRVKQ 39

  Fly   102 INEAFEGLRTHIPTLPY--------------EKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPG 152
            :|..|..||.|||....              .|:||||.|||:|:.||..|.:::.::....:..
  Fly    40 VNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQKQKQ 104

  Fly   153 LSLQR---NYQKEPP--------KKIILKDRTGGVA--HSLSWYRK--GDRYPGSKLYARTWTPE 202
            |.||:   ::|::..        :::.|:..||..:  :|:|.|.|  ....||:       || 
  Fly   105 LHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCKPATSTIPGA-------TP- 161

  Fly   203 DPRGPHSQPLPLYNNSNSNQNQNSNQSSD 231
             |...|::....:.:..:|...:..:..|
  Fly   162 -PNNFHTKLEASFEDYRNNSCSSGTEDED 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 24/65 (37%)
acNP_476824.1 HLH 30..96 CDD:197674 24/65 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.