DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and Mesp1

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001101001.1 Gene:Mesp1 / 308766 RGDID:1311751 Length:242 Species:Rattus norvegicus


Alignment Length:238 Identity:61/238 - (25%)
Similarity:95/238 - (39%) Gaps:61/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SESDDEDDAYSSGFNSDQENTEKTFCPF------SRRSHKP-RRLKCASQMAQ-QRQAANLRERR 97
            |...|.|...|..::||..:..:...|.      :||:..| ||....|::.. |||:|:.||:.
  Rat    23 SMPSDGDSFCSPAWSSDSWDGAQASSPALPCARPARRAGTPGRRGTHGSRLGSGQRQSASEREKL 87

  Fly    98 RMQSINEAFEGLRTHIP--TLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLS----LQ 156
            ||:::..|...||..:|  ..|..:.|:|::||:|||.||..||.::         |||    .|
  Rat    88 RMRTLARALHELRRFLPPSVAPIGQNLTKIETLRLAIRYIGHLSAVL---------GLSEDSLRQ 143

  Fly   157 RNYQKEPPKKIILKDRTGGVAHSL------------SWYRKGDRYPGSKLYARTWTPEDPRGPHS 209
            :.:...|....:..|.....|.||            || .....||..::.|.:|.|..      
  Rat   144 QRHAVSPRGCPLCPDSGLAQAQSLGPHLSPVACSGVSW-GSSPAYPRPRVAAESWDPSF------ 201

  Fly   210 QPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSS 252
                ||..:.|.:.|.               .:|..::.:|||
  Rat   202 ----LYTETASLERQE---------------MEPSPSSPLFSS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 20/53 (38%)
Mesp1NP_001101001.1 HLH 77..130 CDD:278439 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.