DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and Mesp2

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001099743.1 Gene:Mesp2 / 293046 RGDID:1305959 Length:368 Species:Rattus norvegicus


Alignment Length:242 Identity:60/242 - (24%)
Similarity:91/242 - (37%) Gaps:80/242 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ARHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAYSSGFNSDQENTEKTFCPFSRRSHKPRRL 78
            |||....|.|:::.:|.|...:.....|:        |:|......||:..       .:.|||.
  Rat    25 ARHSDSTSPASSSDSSGSCPCYATRPPSQ--------STGPARSARNTQVA-------PNAPRRA 74

  Fly    79 KCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIP--TLPYEKRLSKVDTLKLAISYITFLSEM 141
            :.| ....|||:|:.||:.||:::..|.:.||..:|  ..|..:.|:|::||:|||.||..||.:
  Rat    75 RPA-PAGGQRQSASEREKLRMRTLARALQELRRFLPPSVAPAGQSLTKIETLRLAIRYIGHLSAL 138

  Fly   142 VKKDKNGNEPGLSLQRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPRG 206
            :...::      ||:|.           :.|:...|.|                           
  Rat   139 LGLSED------SLRRR-----------RRRSADAAFS--------------------------- 159

  Fly   207 PHSQPLPLYNNSNSNQNQNSNQSSDDFSGSGADMSDPGAAASIFSSG 253
             |..|                |..||.|.|.|.|..|...:.| |||
  Rat   160 -HRCP----------------QCPDDSSPSQAQMLGPSLGSDI-SSG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 20/53 (38%)
Mesp2NP_001099743.1 HLH 82..135 CDD:278439 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.