DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and FERD3L

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_690862.1 Gene:FERD3L / 222894 HGNCID:16660 Length:166 Species:Homo sapiens


Alignment Length:117 Identity:46/117 - (39%)
Similarity:72/117 - (61%) Gaps:14/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GDEHSSESD-DEDDAYSSGFNSDQENTEKTFCPFSRRSHKPRRLKCASQMAQQRQAANLRERRRM 99
            ||....|.: |:.|    |...::|...:......|    |:|.:..:.  .||||||:|||:||
Human    60 GDPEEEECEVDQGD----GEEEEEEERGRGVSLLGR----PKRKRVITY--AQRQAANIRERKRM 114

  Fly   100 QSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMV---KKDKNG 148
            .::||||:.||..:||..||||||:::||:|||.||:|::|::   :|.::|
Human   115 FNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLESCEKKESG 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 29/54 (54%)
FERD3LNP_690862.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..88 7/31 (23%)
bHLH_TS_FERD3L_NATO3 94..157 CDD:381421 35/64 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.