DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and Tal1

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_006502972.1 Gene:Tal1 / 21349 MGIID:98480 Length:335 Species:Mus musculus


Alignment Length:213 Identity:58/213 - (27%)
Similarity:88/213 - (41%) Gaps:60/213 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ASTSSSDYFFGDEHSSESDDEDDAYSSGFNSDQENTEKTFCPFSRRSHKPRRLKCAS---QMAQQ 87
            ||..|.  |||         |.||:....|:::          .:|...|..::.:.   ....:
Mouse   151 ASLGSG--FFG---------EPDAFPMFTNNNR----------VKRRPSPYEMEISDGPHTKVVR 194

  Fly    88 RQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVK-KDKNGNE- 150
            |...|.|||.|.|::|.||..||..|||.|.:|:|||.:.|:||:.||.||::::. :::.|.: 
Mouse   195 RIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQR 259

  Fly   151 --PGLSLQRNYQKEP-------------PKKIILKD---RTGGVAHSLSWYRKGDRY---PGSKL 194
              ||        |:|             |.:.:|:|   .......||......|.|   |..|.
Mouse   260 AKPG--------KDPVVGAGGGGAGGGIPPEDLLQDVLSPNSSCGSSLDGAASPDSYTEEPTPKH 316

  Fly   195 YARTWTP-----EDPRGP 207
            .:|:..|     .|..||
Mouse   317 TSRSLHPALLPAADGAGP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 26/52 (50%)
Tal1XP_006502972.1 bHLH_TS_TAL1 191..255 CDD:381549 27/63 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.