Sequence 1: | NP_001262334.1 | Gene: | Fer1 / 2768661 | FlyBaseID: | FBgn0037475 | Length: | 256 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006502972.1 | Gene: | Tal1 / 21349 | MGIID: | 98480 | Length: | 335 | Species: | Mus musculus |
Alignment Length: | 213 | Identity: | 58/213 - (27%) |
---|---|---|---|
Similarity: | 88/213 - (41%) | Gaps: | 60/213 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 ASTSSSDYFFGDEHSSESDDEDDAYSSGFNSDQENTEKTFCPFSRRSHKPRRLKCAS---QMAQQ 87
Fly 88 RQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVK-KDKNGNE- 150
Fly 151 --PGLSLQRNYQKEP-------------PKKIILKD---RTGGVAHSLSWYRKGDRY---PGSKL 194
Fly 195 YARTWTP-----EDPRGP 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fer1 | NP_001262334.1 | HLH | 92..144 | CDD:197674 | 26/52 (50%) |
Tal1 | XP_006502972.1 | bHLH_TS_TAL1 | 191..255 | CDD:381549 | 27/63 (43%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |