DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and Ptf1a

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_061279.2 Gene:Ptf1a / 19213 MGIID:1328312 Length:324 Species:Mus musculus


Alignment Length:164 Identity:75/164 - (45%)
Similarity:99/164 - (60%) Gaps:25/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SHKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYIT 136
            :.:.||::..:::.|.|||||:||||||||||:||||||:|||||||||||||||||:|||.||.
Mouse   146 ARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYIN 210

  Fly   137 FLSEMVKKD------KNGNEPGLSLQRNYQKEPP----KKIIL----------KDRTGGV----A 177
            ||||:|:.|      ..|...|....|:..::.|    :|:|:          .|...|:    .
Mouse   211 FLSELVQADLPLRGSGAGGCGGPGGSRHLGEDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAG 275

  Fly   178 HSLSWY-RKGDRYPGSKLYARTWTPEDPRGPHSQ 210
            |||||. .|..:.......|:.|||||||..:|:
Mouse   276 HSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 44/51 (86%)
Ptf1aNP_061279.2 HLH 162..217 CDD:238036 47/54 (87%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..324 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837015
Domainoid 1 1.000 94 1.000 Domainoid score I7513
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I4801
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008172
OrthoInspector 1 1.000 - - oto94741
orthoMCL 1 0.900 - - OOG6_108748
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 1 1.000 - - X6136
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.