DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and hlh-6

DIOPT Version :10

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_496070.1 Gene:hlh-6 / 188539 WormBaseID:WBGene00001952 Length:268 Species:Caenorhabditis elegans


Alignment Length:125 Identity:37/125 - (29%)
Similarity:63/125 - (50%) Gaps:12/125 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DAYSSGFNSDQENTEKTFCPFSRRSHKPRRLKCASQMAQQRQAA---NLRERRRMQSINEAFEGL 109
            |..|:.|       :|...||:..:..|..::...|......:.   |.|||.|::::|:.:|.|
 Worm   139 DTSSNAF-------KKYVNPFAPEATVPLPVELEDQYGPYSSSVWKRNERERCRVRNVNDGYERL 196

  Fly   110 RTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSLQRNYQKEPPKKIIL 169
            |.|:|....|||:||||||:|||.||..|..:::.:.  ::........:|:|....|::
 Worm   197 RKHLPVHFDEKRISKVDTLRLAIRYIKHLDNLLRSEL--HQYNCKCFNGFQEESEGNILI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 bHLH_TS_PTF1A 87..142 CDD:381423 26/57 (46%)
hlh-6NP_496070.1 PRK10263 <34..>133 CDD:236669
bHLH_TS_ASCL3_like 174..229 CDD:381567 26/54 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.