DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and hlh-13

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_508725.1 Gene:hlh-13 / 185980 WormBaseID:WBGene00001957 Length:147 Species:Caenorhabditis elegans


Alignment Length:114 Identity:44/114 - (38%)
Similarity:63/114 - (55%) Gaps:25/114 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 QQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNE 150
            ::||.|::|||:||.|||.||..||.:|||.||||||||:|||.|||:||..|.::::..:   :
 Worm    41 EERQTASIRERKRMCSINVAFIELRNYIPTFPYEKRLSKIDTLNLAIAYINMLDDVLRTPE---D 102

  Fly   151 PGLSLQRNYQKEPPKKIILKDRTGGVA-------------HSLSWYRKG 186
            .|..:|         |.:...|||.:.             :.:.|.|.|
 Worm   103 SGQYIQ---------KCVHMARTGQIGAPAWSTSDLLARLNWIKWRRLG 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 32/51 (63%)
hlh-13NP_508725.1 HLH 43..93 CDD:278439 34/49 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I6183
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2562
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.