DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and Ascl2

DIOPT Version :10

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_032580.2 Gene:Ascl2 / 17173 MGIID:96920 Length:263 Species:Mus musculus


Alignment Length:87 Identity:31/87 - (35%)
Similarity:45/87 - (51%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CPFSRRSHKPRRLKCASQM------AQQRQAA----NLRERRRMQSINEAFEGLRTHIPTLPYEK 120
            |...||...|..|:|:.:.      |....||    |.|||.|::.:|..|:.||.|:|.....|
Mouse    88 CAARRRQASPELLRCSRRRRSGATEASSSSAAVARRNERERNRVKLVNLGFQALRQHVPHGGANK 152

  Fly   121 RLSKVDTLKLAISYITFLSEMV 142
            :||||:||:.|:.||..|..::
Mouse   153 KLSKVETLRSAVEYIRALQRLL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 bHLH_TS_PTF1A 87..142 CDD:381423 24/58 (41%)
Ascl2NP_032580.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..126 4/21 (19%)
bHLH_TS_ASCL2_Mash2 128..180 CDD:381586 19/47 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..248
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.