DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and Hand1

DIOPT Version :10

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_032239.1 Gene:Hand1 / 15110 MGIID:103577 Length:216 Species:Mus musculus


Alignment Length:131 Identity:42/131 - (32%)
Similarity:67/131 - (51%) Gaps:23/131 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PFSRRSHKPRRLKC-ASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKL 130
            |.:|.|..|.||:. .|::.:::.:...:||||.:|||.||..||..||.:|.:.:|||:.||:|
Mouse    74 PDARPSQSPGRLEALGSRLPKRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRL 138

  Fly   131 AISYITFLSEMVKKDKNGNEPGL--------------SLQRNYQKEP--------PKKIILKDRT 173
            |.|||.:|.:::.||....:|..              ..:|...::|        |.:..:|.||
Mouse   139 ATSYIAYLMDVLAKDAQAGDPEAFKAELKKTDGGRESKRKRELPQQPESFPPASGPGEKRIKGRT 203

  Fly   174 G 174
            |
Mouse   204 G 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 bHLH_TS_PTF1A 87..142 CDD:381423 25/54 (46%)
Hand1NP_032239.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..109 11/34 (32%)
bHLH_TS_HAND1 94..153 CDD:381522 25/58 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203 4/37 (11%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.