DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and Fer2

DIOPT Version :10

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_061508640.1 Gene:Fer2 / 1271473 VectorBaseID:AGAMI1_010069 Length:264 Species:Anopheles gambiae


Alignment Length:111 Identity:47/111 - (42%)
Similarity:63/111 - (56%) Gaps:23/111 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 QRQAANLRERRRM-----------QSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSE 140
            |||..|:|||:||           .|||.||:.||.|:||.||||||||:|||:|||:||..|.|
Mosquito   125 QRQQTNVRERKRMMRSAPNGSTINSSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYIALLRE 189

  Fly   141 MVKKDKNGNEPGLSLQRNYQKEPPKKIILKDR----TGGVAHSLSW 182
            :::.|   .:|...:::..:.|     |..||    |..:...|||
Mosquito   190 VLEAD---YDPLTYVEKCLRGE-----IKADRAHWNTSDLTARLSW 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 bHLH_TS_PTF1A 87..142 CDD:381423 37/65 (57%)
Fer2XP_061508640.1 None

Return to query results.
Submit another query.