DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1 and tal1

DIOPT Version :9

Sequence 1:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001135468.1 Gene:tal1 / 100196924 XenbaseID:XB-GENE-479827 Length:388 Species:Xenopus tropicalis


Alignment Length:239 Identity:61/239 - (25%)
Similarity:93/239 - (38%) Gaps:71/239 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RHFFEGSQATNASTSSSDYFFGDEHSSESDDEDDAYSSGFNSDQENTEKTFCPFSRRSHKPRRLK 79
            |....|...|.|| .:|.||          |:.:||....|:            ||...:|...:
 Frog   203 RTMLYGLNQTLAS-GNSGYF----------DDPEAYPMFTNN------------SRVKRRPGPYE 244

  Fly    80 CASQMAQQ-----RQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLS 139
            .......|     |...|.|||.|.|::|.||..||..|||.|.:|:|||.:.|:||:.||.||:
 Frog   245 VEISEGPQTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA 309

  Fly   140 EMV-KKDKNGNEPGLSLQRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPG---SKLYARTWT 200
            ::: .:::.||      |||                          ||::..|   .:|.....:
 Frog   310 KLLDDQEEEGN------QRN--------------------------KGNKDNGMVQQELLQDMLS 342

  Fly   201 PEDPRGPHSQPLPL-------YNNSNSNQNQNSNQSSDDFSGSG 237
            |....|.....:|.       ::..:|..::|.:|:.....|||
 Frog   343 PNSSCGSSLDGVPSPDSYSEEHDTLDSKHSRNLHQAMLPVDGSG 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1NP_001262334.1 HLH 92..144 CDD:197674 26/52 (50%)
tal1NP_001135468.1 PHA03247 <6..195 CDD:223021
bHLH_TS_TAL1 254..318 CDD:381549 27/63 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.