DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HTRA2 and CG9588

DIOPT Version :10

Sequence 1:NP_037379.1 Gene:HTRA2 / 27429 HGNCID:14348 Length:458 Species:Homo sapiens
Sequence 2:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster


Alignment Length:183 Identity:46/183 - (25%)
Similarity:76/183 - (41%) Gaps:42/183 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   299 AAIDFGNSGGPLVNLDG---EVIGVNTMKVTAGISFAIPSDRLREFLHR---------------- 344
            ||.|.....||||:.:|   ..|.|..:::.......:.:|. :|.:::                
  Fly    33 AANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQNDH-KELMNQIQTLLNQYHSEIATTD 96

Human   345 GEKKNSSSGIS-GSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLR 408
            .|..|.:|.:. .|.|...|..:..|:|:               :..|:::.|...|||.||||.
  Fly    97 PELVNRASALDLDSDRSPGGANITDLAPA---------------RAIVVVNLVSPDSPAERAGLC 146

Human   409 PGDVILAIGEQMVQNAE----DVYEAVRT-QSQ-LAVQIRRGRETLTLYVTPE 455
            .||.||..|.....|.:    .:.|.||. ||| :.::::||.:.|.|.:.|:
  Fly   147 AGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HTRA2NP_037379.1 IAP-binding motif 134..137
Serine protease 166..342 12/45 (27%)
DegQ 182..455 CDD:440035 45/181 (25%)
CG9588NP_650301.1 Nas2_N 11..90 CDD:465689 12/57 (21%)
RseP <130..>208 CDD:440513 25/70 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.