DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HTRA2 and CG9588

DIOPT Version :9

Sequence 1:NP_037379.1 Gene:HTRA2 / 27429 HGNCID:14348 Length:458 Species:Homo sapiens
Sequence 2:NP_650301.1 Gene:CG9588 / 41672 FlyBaseID:FBgn0038166 Length:220 Species:Drosophila melanogaster


Alignment Length:183 Identity:46/183 - (25%)
Similarity:76/183 - (41%) Gaps:42/183 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   299 AAIDFGNSGGPLVNLDG---EVIGVNTMKVTAGISFAIPSDRLREFLHR---------------- 344
            ||.|.....||||:.:|   ..|.|..:::.......:.:|. :|.:::                
  Fly    33 AANDNVGMSGPLVDAEGFPRNDIDVYQVRLARQTIICLQNDH-KELMNQIQTLLNQYHSEIATTD 96

Human   345 GEKKNSSSGIS-GSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLR 408
            .|..|.:|.:. .|.|...|..:..|:|:               :..|:::.|...|||.||||.
  Fly    97 PELVNRASALDLDSDRSPGGANITDLAPA---------------RAIVVVNLVSPDSPAERAGLC 146

Human   409 PGDVILAIGEQMVQNAE----DVYEAVRT-QSQ-LAVQIRRGRETLTLYVTPE 455
            .||.||..|.....|.:    .:.|.||. ||| :.::::||.:.|.|.:.|:
  Fly   147 AGDAILRFGSINSGNFKGDLAQIGELVRNMQSQNVQLKVKRGEQQLDLILVPK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HTRA2NP_037379.1 IAP-binding motif 134..137
DegQ 150..>453 CDD:333159 45/179 (25%)
Serine protease 166..342 12/45 (27%)
CG9588NP_650301.1 PDZ 116..186 CDD:238080 24/84 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.