DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HTRA2 and CG3589

DIOPT Version :9

Sequence 1:NP_037379.1 Gene:HTRA2 / 27429 HGNCID:14348 Length:458 Species:Homo sapiens
Sequence 2:NP_611968.1 Gene:CG3589 / 37966 FlyBaseID:FBgn0035065 Length:509 Species:Drosophila melanogaster


Alignment Length:234 Identity:56/234 - (23%)
Similarity:88/234 - (37%) Gaps:68/234 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   182 GSGFVVAADG--LIVTNAHVV-----------ADRR-RVRVRLLSGDTYE----AVVTAVDPVAD 228
            |:|..:....  .|:|.||||           |||. :..|...:.|:.:    |::||...|.:
  Fly   305 GTGTFIRVHNKRFILTCAHVVGQNIETVNCRAADREFQSEVIWCNPDSDKPFDLALLTAPQDVPE 369

Human   229 IATLRIQTKEPLPTLPLGRS-ADVRQGEFVVAMGSPFAL--------QNTITSGIVSSAQRPARD 284
            ...:|           |.|| |.|  |:.|...|.|:.:        ..:|..|.|......|  
  Fly   370 QCCVR-----------LARSPATV--GQMVYNAGFPYYVNFSFRHDFNPSIFQGRVIKCDTGA-- 419

Human   285 LGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIG--VNTMK----VTAGISFAIPSDRLREFLH 343
                      |.:|.::..|.||||:.:.:|.::|  |:.:|    |...|:.|||...:|..|.
  Fly   420 ----------IMSDGSVQAGQSGGPMFDQNGCILGVCVSNIKLDDVVYPNINTAIPICDIRNTLQ 474

Human   344 RGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREP 382
            :..:.|..:.:|.          |..||.:.....|..|
  Fly   475 QFARTNDLNVLSN----------LVASPDVHRVWSLEMP 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HTRA2NP_037379.1 IAP-binding motif 134..137
DegQ 150..>453 CDD:333159 56/234 (24%)
Serine protease 166..342 48/192 (25%)
CG3589NP_611968.1 Trypsin 296..471 CDD:278516 47/190 (25%)
Trypsin_2 305..445 CDD:290102 39/164 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.