DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HTRA2 and psmd-9

DIOPT Version :10

Sequence 1:NP_037379.1 Gene:HTRA2 / 27429 HGNCID:14348 Length:458 Species:Homo sapiens
Sequence 2:NP_001379558.1 Gene:psmd-9 / 24104302 WormBaseID:WBGene00016623 Length:197 Species:Caenorhabditis elegans


Alignment Length:70 Identity:19/70 - (27%)
Similarity:29/70 - (41%) Gaps:5/70 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   391 VLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQ-----LAVQIRRGRETLTL 450
            |.|..|:..|||...|.|..|:|:..|.....|..|:.|..:...|     :.|.:.|....:.|
 Worm   108 VKISSVVELSPADIGGFRKDDLIIQYGNLHHGNFNDMQEVAQITKQSEDKIIRVTVIRENRPVRL 172

Human   451 YVTPE 455
            .:.|:
 Worm   173 EICPK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HTRA2NP_037379.1 IAP-binding motif 134..137
Serine protease 166..342
DegQ 182..455 CDD:440035 18/68 (26%)
psmd-9NP_001379558.1 Nas2_N 7..81 CDD:465689
PDZ_6 110..165 CDD:436067 15/54 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.