DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLRA2 and pHCl-1

DIOPT Version :9

Sequence 1:NP_001112357.1 Gene:GLRA2 / 2742 HGNCID:4327 Length:452 Species:Homo sapiens
Sequence 2:NP_001261898.1 Gene:pHCl-1 / 39730 FlyBaseID:FBgn0264908 Length:978 Species:Drosophila melanogaster


Alignment Length:423 Identity:124/423 - (29%)
Similarity:197/423 - (46%) Gaps:79/423 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    40 QTLSPSDFLDKLMGRTSGYDARI-------------------------RPNFKGPPVNVTCNIFI 79
            ::.|..:.||.|:.: ..||.|:                         ||:.:| .:.|..|:.:
  Fly   333 ESSSDKEILDLLLEK-KRYDKRLLPPVNDEDFCCGLQSPDMATNQNARRPHNRG-TLTVNVNVLL 395

Human    80 NSFGSVTETTMDYRVNIFLRQQWNDSRLAY---SEYPDDSLDLDPSML---DSIWKPDLFFANEK 138
            .|..|..|:::.|.|...|.|||||.||.|   |.|  |.|    :.|   ||||.||.:|... 
  Fly   396 LSLASPDESSLKYEVEFLLNQQWNDPRLQYGNKSHY--DFL----NALHHHDSIWTPDTYFIMH- 453

Human   139 GANFHD-VTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIF 202
             .:|.| :...:..|||.:||.:.|::|..|.|||...|..||.|...|:..:||..|....:.:
  Fly   454 -GDFKDPIIPMHFALRIFRNGTITYAMRRHLILSCQGSLHIFPFDDPKCSFSMESISYEEAQIKY 517

Human   203 EWLSD-GPVQVAEGL-TLPQFILKEEKELGYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPS 265
            .|.:| ..::.:..| ||..:::|.:...  |.::...|.::|::|:....|...||...::||.
  Fly   518 VWKNDEDTLRKSPSLTTLNAYLIKNQTTA--CDQNSWRGNYSCLQVELTFTRDRAYYFTTVFIPG 580

Human   266 LLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFA 330
            :::|..|:::||:..:|.||||.:|:||:|...|.|:|.|::||.||.:.|:::|..||:.|::|
  Fly   581 IILVTSSFITFWLEWNAVPARVMIGVTTMLNFFTTSNGFRSTLPVVSNLTAMNVWDGVCMCFIYA 645

Human   331 ALLEYAAVNFVSRQ---HKEFLRLRRRQKRQNKEEDVTRESRFNFSGYG---------------- 376
            :|||:..||:|.|:   |....|        ..|..||:......|..|                
  Fly   646 SLLEFVCVNYVGRKRPLHNVVYR--------PGENPVTQRLPAVLSRIGVILASPLASAAATPAM 702

Human   377 --MGHCLQVKDGTAVK----ATPANPLPQPPKD 403
              ||....:..||...    |||..|....|::
  Fly   703 SMMGGATPMSSGTPAASSSVATPGTPRITDPEE 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLRA2NP_001112357.1 LIC 46..441 CDD:273305 123/417 (29%)
Strychnine-binding. /evidence=ECO:0000250|UniProtKB:O93430 236..241 1/4 (25%)
pHCl-1NP_001261898.1 Neur_chan_LBD 338..566 CDD:280998 68/239 (28%)
Neur_chan_memb 578..>682 CDD:280999 41/111 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D614790at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18945
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.