DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GLRA2 and CG8916

DIOPT Version :9

Sequence 1:NP_001112357.1 Gene:GLRA2 / 2742 HGNCID:4327 Length:452 Species:Homo sapiens
Sequence 2:NP_573090.3 Gene:CG8916 / 32553 FlyBaseID:FBgn0030707 Length:612 Species:Drosophila melanogaster


Alignment Length:508 Identity:160/508 - (31%)
Similarity:243/508 - (47%) Gaps:117/508 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    45 SDFLDKLMGRTSGYD-ARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLA 108
            |..|:.|:.|   |: :::..:.:|.|..|..||.|.|.|.|:|..|||.::.:.||.|.|.||:
  Fly   109 SMILENLLKR---YEQSQLPTHGQGVPTVVQTNILIRSMGPVSELDMDYSMDCYFRQYWRDKRLS 170

Human   109 YSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCP 173
            : :.|..||.|...|||.||:||.:|.|.|.:..|.:|..|||||:.:||.:|||:|||:..:||
  Fly   171 F-KGPIKSLSLSIKMLDKIWRPDTYFYNGKHSQIHMITVPNKLLRLDQNGGILYSMRLTIKATCP 234

Human   174 MDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLS-DGPVQVAEGLTLPQFILKEEKELGYCTKHYN 237
            |:|:|||||.|:|.:.:.|:||....||:||.: |..|....|:||.||.|.......:.|.. .
  Fly   235 MELQNFPMDRQSCPLVIGSYGYINQQLIYEWKNQDDAVSFVPGMTLNQFDLISMMHRNFTTVR-R 298

Human   238 TGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSS 302
            .|.|:.:.|.|:|:|..||:|||:|:|.:|||:||||||||:.:|...||:|.:|:|||::|.|.
  Fly   299 EGDFSVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDRVSLCVTSVLTLSTISL 363

Human   303 GSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQNK------- 360
            .||..||||.|..|:|.::.:..|:..|.|||:|.|::       |.:|...:..|.:       
  Fly   364 DSRTDLPKVKYATALDWFLLMSFLYCIATLLEFAGVHY-------FTKLGSGESPQLEDQWEDIC 421

Human   361 ------------------------EEDVTRESRFNFSGYGMGHCLQVKDGTAV------------ 389
                                    :||.:..|..:.:..|....::.|.|..|            
  Fly   422 IANSLSDHAGEVDGDGEADADPFADEDSSNGSENDDNEAGASESVESKSGVCVCNKNDALGLEYE 486

Human   390 ----------------------KATPANPLP---------QPP------------KDGDAIKKK- 410
                                  ...|:..||         :||            |..::.:|: 
  Fly   487 VSLQNSLAGAGFLKRNAIFCPTYNDPSYILPNTMERTTQTEPPAVSRLHQMWMCLKSDNSFRKQR 551

Human   411 ----------------FVDRAKRIDTISRAAFPLAFLIFNIFYWITYKIIRHE 447
                            :|:....||.::|.|||::|...|:.||..|.:.:.|
  Fly   552 ERNAAAQKSEQGGANCYVNSVSLIDRVARIAFPMSFAFLNLLYWWAYGMYKKE 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GLRA2NP_001112357.1 LIC 46..441 CDD:273305 157/499 (31%)
Strychnine-binding. /evidence=ECO:0000250|UniProtKB:O93430 236..241 1/4 (25%)
CG8916NP_573090.3 LIC 92..598 CDD:273305 158/500 (32%)
Neur_chan_LBD 111..315 CDD:280998 85/208 (41%)
Neur_chan_memb 322..>403 CDD:280999 39/87 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.