DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sergef and Rcc1

DIOPT Version :9

Sequence 1:XP_006541006.1 Gene:Sergef / 27414 MGIID:1351630 Length:465 Species:Mus musculus
Sequence 2:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster


Alignment Length:358 Identity:95/358 - (26%)
Similarity:155/358 - (43%) Gaps:63/358 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    69 GDLFVCGLNKDGQLGLGHTEEVLRFTICKPLRGCP-IRQVACGWDFTIMLTEKGQVLSCGSNAFG 132
            |::.|||....||||||  |::|......|:.|.| ...::.|....::||:.|.:.|.|.|..|
  Fly    42 GNVLVCGNGDVGQLGLG--EDILERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGCNDEG 104

Mouse   133 QLG---VPHGPRKCVVPQAIECLREKVVCVAAGLRHALATTATGSVFQWGTGLASSGRRLCPGQN 194
            .||   ...|...  .|..|: |..|.:|::||..|:......|.||.||:...|.|       |
  Fly   105 ALGRDTSEDGSES--KPDLID-LPGKALCISAGDSHSACLLEDGRVFAWGSFRDSHG-------N 159

Mouse   195 LPLFLTAKEPSRVTGLENSTAVCAVA-GSDHSASLTDTGELYVWGRNKHGQ---LASRAVF---- 251
            :.|.:...:.:.:..:| .|..|::| |:||...||..|:::..|..:.||   |:.|::.    
  Fly   160 MGLTIDGNKRTPIDLME-GTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGR 223

Mouse   252 -----LPLPQRI---EAHYFQDEKVTAVW-SGWTHLVAKTETGKVFTWGRADYGQLGRRLEPPE- 306
                 |..|.::   .|..|:     |:| :.:...:.:::|..::..|..::.||....:..| 
  Fly   224 RGKRDLLRPTQLIITRAKPFE-----AIWATNYCTFMRESQTQVIWATGLNNFKQLAHETKGKEF 283

Mouse   307 AQKPVEQDSSLAFQGPQNSVPSPLHCLTGATEISCGSEHNLAVIRD-KCCSWGWNEHGMCGDG-T 369
            |..|::.:                  |.....|:.|..|.:.:..| ||...|..|:|..|.| .
  Fly   284 ALTPIKTE------------------LKDIRHIAGGQHHTVILTTDLKCSVVGRPEYGRLGLGDV 330

Mouse   370 ESNVWTPTPVQALPPSPSRLLLVGCGAGHSLAV 402
            :..|..||.|:.|   ..:::.||||...|.||
  Fly   331 KDVVEKPTIVKKL---TEKIVSVGCGEVCSYAV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SergefXP_006541006.1 ATS1 22..370 CDD:227511 83/324 (26%)
RCC1 356..402 CDD:366085 15/46 (33%)
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 16/48 (33%)
RCC1 92..141 CDD:278826 16/51 (31%)
RCC1_2 131..158 CDD:290274 9/26 (35%)
RCC1 144..193 CDD:278826 16/56 (29%)
RCC1_2 182..209 CDD:290274 8/26 (31%)
RCC1 363..414 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833509
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.