DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dusp13 and puc

DIOPT Version :9

Sequence 1:XP_036014538.1 Gene:Dusp13 / 27389 MGIID:1351599 Length:324 Species:Mus musculus
Sequence 2:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster


Alignment Length:152 Identity:52/152 - (34%)
Similarity:81/152 - (53%) Gaps:12/152 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse   170 TH-INEVWPNLFLGDAYAARDKGRLIQLGITHVVNVAAGKFQVDTGAKFYRGTPLEYYGIEADDN 233
            || .:.|:|:|.||:...|.|..   .:|...|:||..    ........:|  |:|..|.|.|.
  Fly   131 THPASPVFPHLLLGNGRDADDPS---SVGANCVLNVTC----QSPNESHLQG--LKYMQIPASDT 186

Mouse   234 PFFDLSVHFLPVARYIRDALNIPRSRVLVHCAMGVSRSATIVLAFLMIFENMTLVDAIQTVQAHR 298
            |..::..:|.....:|.||.. ..||||:||..|:||||||.:|::|.:::::|::|.:.|:..|
  Fly   187 PHQNIKQYFQEAYDFIEDARK-TGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVAR 250

Mouse   299 D-ICPNSGFLRQLQVLDNRLRR 319
            . |.||..|:.||..|:..||:
  Fly   251 PIISPNLNFMGQLLELEQNLRK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dusp13XP_036014538.1 PTP_DSP_cys 154..317 CDD:421693 50/148 (34%)
pucNP_524273.1 DSPc 133..267 CDD:238073 47/143 (33%)
CDC14 <193..272 CDD:225297 31/79 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.