DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magel2 and MAGE

DIOPT Version :9

Sequence 1:NP_038807.4 Gene:Magel2 / 27385 MGIID:1351648 Length:1284 Species:Mus musculus
Sequence 2:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster


Alignment Length:222 Identity:59/222 - (26%)
Similarity:107/222 - (48%) Gaps:13/222 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse  1030 SVSRGSSAAQEDPDRES-QPLSPLDERANALVQFLLVKDQAKVPVQLSEMVNVVIREYKDDSLDI 1093
            |.||.:.:....|.:|: ||:..:|.:..|::.::|.....|:|::..:::.|.     .|..::
  Fly     3 STSRAARSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVA-----GDKSEL 62

Mouse  1094 INR---ANTKLECTFGCQLKEVDTKTHTYIIVNKMAYPQCNLLASYLERPKFSLLMVVLSLIFMK 1155
            ..|   ....|..|||..|..:|..|.|:|...:......:.|.. .:||:|:||.::|..||::
  Fly    63 KKRLPLVTNLLAETFGIILTPLDATTKTFICTAEEPVASIHELTP-AQRPQFTLLYIILMYIFLR 126

Mouse  1156 GYCIRENLLFSFLFQLGLDVQETSGLFRIT-KKLITSVFVRHRYL--EYRQIPFTEPAEYELLWG 1217
            |..|.::.|:..|..|.:...|..|.|... :|.|...||:.:||  |..|:...:.::...|||
  Fly   127 GNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWG 191

Mouse  1218 PRAFLETNRVHILRFLAALYENQPQIW 1244
            |||..|.....:::|.:.|....|:::
  Fly   192 PRAKAEFTFEQMVQFASKLLNQHPKVF 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Magel2NP_038807.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..208
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..431
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 673..717
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 747..792
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 839..860
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 913..964
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 985..1051 7/21 (33%)
MAGE 1059..1223 CDD:279759 46/169 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1261..1284
MAGENP_649702.2 MAGE 36..201 CDD:279759 47/170 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842088
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.